PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG006840t1
Common NameTCM_006840
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family bZIP
Protein Properties Length: 162aa    MW: 18226.3 Da    PI: 6.9739
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG006840t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_147.73.3e-153189563
                      CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1  5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63
                      ++ +r+++NRe+ArrsR RK++ ++ L   v +L +eN++ + +++ +++++ ++++e+
  Thecc1EG006840t1 31 RKRKRMISNRESARRSRMRKQKHLDDLMAQVTQLRKENHQIITRINIITQHYLNVEAEN 89
                      6789***********************************************99998887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1702.2E-122080No hitNo description
SMARTSM003382.4E-202791IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.9672992IPR004827Basic-leucine zipper domain
PfamPF001706.7E-123186IPR004827Basic-leucine zipper domain
SuperFamilySSF579595.0E-133183No hitNo description
CDDcd147021.64E-193282No hitNo description
PROSITE patternPS0003603449IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 162 aa     Download sequence    Send to blast
MASSSGTSSG SSTLLQNSGS EEDLQALMDE RKRKRMISNR ESARRSRMRK QKHLDDLMAQ  60
VTQLRKENHQ IITRINIITQ HYLNVEAENS VLKAQANELS HRLQSLNEIN SYLNANNGSN  120
FDAEDATSLA FTEPADSFFN PFNLAYLKQP IMASADNMLQ Y*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13051RKRKRMISNRESARRSRMRKQK
24350RRSRMRKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007042116.11e-115Basic leucine-zipper 44
TrEMBLA0A061DZX31e-115A0A061DZX3_THECC; Basic leucine-zipper 44
STRINGPOPTR_0004s16560.13e-69(Populus trichocarpa)
STRINGGLYMA12G04440.14e-69(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM50128154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75390.16e-50basic leucine-zipper 44
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]